Hoax Clearing Center

Return-Path: <joanne.pieters@broad-bandsearch.net>

Received: from m.launchco.com ([127.0.0.1]) by m.launchco.com with LMTP id APyMNZj8Ll4vOgAAa1G0NA for <dropbox@plan.io>; Mon, 27 Jan 2020 16:07:04 +0100

Received: from pdx1-sub0-mail-mx26.g.dreamhost.com (mx1.dreamhost.com [64.90.62.163]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (No client certificate requested) by m.launchco.com (Postfix) with ESMTPS id 66F6E8320E for <inbox+rlxc+36be+hoax-clearing-center@plan.io>; Mon, 27 Jan 2020 16:07:04 +0100

Received: from vade-backend18.dreamhost.com (fltr-in1.mail.dreamhost.com [66.33.205.212]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (No client certificate requested) by pdx1-sub0-mail-mx26.g.dreamhost.com (Postfix) with ESMTPS id 90EC49F7D1 for <lapor@turnbackhoax.id>; Mon, 27 Jan 2020 07:07:01 -0800

Received: from mail-wr1-f66.google.com (mail-wr1-f66.google.com [209.85.221.66]) by vade-backend18.dreamhost.com (Postfix) with ESMTPS id 291F640009802 for <lapor@turnbackhoax.id>; Mon, 27 Jan 2020 07:07:01 -0800

Received: by mail-wr1-f66.google.com with SMTP id t2so11734631wrr.1 for <lapor@turnbackhoax.id>; Mon, 27 Jan 2020 07:07:01 -0800

Received: from 968012905573 named unknown by gmailapi.google.com with HTTPREST; Mon, 27 Jan 2020 07:06:58 -0800

Date: Mon, 27 Jan 2020 07:06:58 -0800

From: Joanne Pieters <joanne.pieters@broad-bandsearch.net>

To: lapor@turnbackhoax.id

Message-ID: <CAPQAFKnewRsP8BVK98hoi9YDrPFhNQFgXmQv44VrQkmBy2WyDw@mail.gmail.com>

In-Reply-To: <CAPQAFKmoU1rt510pKiYJuuZX3Gm=KcORk5VjLbWK19DDog852w@mail.gmail.com>

References: <CAPQAFKmoU1rt510pKiYJuuZX3Gm=KcORk5VjLbWK19DDog852w@mail.gmail.com>

<CAPQAFK=_m1zvg4LjNU=VZ1tyQEdbp6UapL-vMOg5ycXinrw00w@mail.gmail.com>

Subject: Re: Let's talk about Internet Hoaxes!

Mime-Version: 1.0

Content-Type: multipart/alternative;

boundary=00000000000080265d059d2075f5

Content-Transfer-Encoding: 7bit

X-He-Spam-Score: -0.5

Delivered-To: dropbox@plan.io

X-Spam-Checker-Version: SpamAssassin 3.4.2 (2018-09-13) on m.launchco.com

X-Spam-Level:

X-Spam-Status: No, score=-0.5 required=5.0 tests=BAYES_00,DKIM_SIGNED,

DKIM_VALID,DKIM_VALID_AU,HTML_IMAGE_ONLY_28,HTML_MESSAGE,

HTTPS_HTTP_MISMATCH,RCVD_IN_DNSWL_NONE,RCVD_IN_MSPIKE_H2,SPF_HELO_NONE,

T_REMOTE_IMAGE,UNPARSEABLE_RELAY autolearn=no autolearn_force=no version=3.4.2

X-Spam-Report: * -0.0 RCVD_IN_DNSWL_NONE RBL: Sender listed at *

https://www.dnswl.org/, no trust * [64.90.62.163 listed in list.dnswl.org] *

-1.9 BAYES_00 BODY: Bayes spam probability is 0 to 1% * [score: 0.0000] * -0.0

RCVD_IN_MSPIKE_H2 RBL: Average reputation (+2) * [64.90.62.163 listed in

wl.mailspike.net] * 0.0 SPF_HELO_NONE SPF: HELO does not publish an SPF Record

* 0.0 HTML_MESSAGE BODY: HTML included in message * 0.1 HTTPS_HTTP_MISMATCH

BODY: No description available. * 1.4 HTML_IMAGE_ONLY_28 BODY: HTML: images

with 2400-2800 bytes of * words * -0.1 DKIM_VALID_AU Message has a valid DKIM

or DK signature from * author's domain * -0.1 DKIM_VALID Message has at least

one valid DKIM or DK signature * 0.1 DKIM_SIGNED Message has a DKIM or DK

signature, not necessarily * valid * 0.0 UNPARSEABLE_RELAY Informational:

message has unparseable relay * lines * 0.0 T_REMOTE_IMAGE Message contains an

external image

X-Spam-Score: -0.5

Envelope-to: inbox+rlxc+36be+hoax-clearing-center@plan.io

Authentication-Results: m.launchco.com; dmarc=pass (p=none dis=none)

header.from=broad-bandsearch.net

Authentication-Results: m.launchco.com; dkim=pass (1024-bit key; unprotected)

header.d=broad-bandsearch.net header.i=@broad-bandsearch.net

header.b="eVx3SxhX"; dkim-atps=neutral

Authentication-Results: vade-backend18.dreamhost.com; dkim=pass

reason="1024-bit key; unprotected key" header.d=broad-bandsearch.net

header.i=@broad-bandsearch.net header.b=eVx3SxhX; dkim-adsp=pass;

dkim-atps=neutral

DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=broad-bandsearch.net;

s=google;

h=from:in-reply-to:references:mime-version:date:message-id:subject:to;

bh=dAStIOtwiy5d2cHll7uSfcucVkP+K1JBqXg0k9k892s=;

b=eVx3SxhXdFVsZ5Rw6g6seu7B3ZtCTYcq8JyGGpTN5T8oiZhIg+u8K77F4nu0EWtiq8

JoT3GXJOo0rO0PixXiQuPZ+68gDxyHI0grqTbN1llWFqERdNoZCUW0wsu4i/IsZIbORd

xncCt6G5WRjWyPzrcfsDf/vOlKyj6S4vzYRdE=

X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net;

s=20161025; h=x-gm-message-state:from:in-reply-to:references:mime-version:date

:message-id:subject:to; bh=dAStIOtwiy5d2cHll7uSfcucVkP+K1JBqXg0k9k892s=;

b=bWwFrJQhB3vS6plV6RmvNBoU6l8oV2O3PldoZvTiZpsKY6b08DeBA90ewPQcGNo6Xj

sOD/dvYdTplI2PUh6Pi2lfZsNEm3AiD3otvtK0V3iKCiFV19qfhXJfUsh46Mn0lkdoPe

H6KG+1S1vtxPkrcx2J84jdjMRy8QRC8ZwIEb4L+AlcubhMjGbh9ImFkPU1EHOXNHRQwk

pk2zNK37SAXWsVSMe4wt+Mj4NywHIepG/DGrtGvcuUzaml8KPCVaRuTsTIPCiRwZ77zu

09wlubNFGenBwYH4yKVyFoLviVgNv6VhXXGuCjpV9dpn7BINoFRWbq1wXuN4B0tjGtKf /hsw==

X-Gm-Message-State: APjAAAXv1ppcwsF8m0fJtrdPQDZVYPb4RP8voOY/BWPqtiTQillW4L78

3IimzCKu9QshbSUQVRD7baG+g4FAQUSt42XgV+5DPZuw

X-Google-Smtp-Source: APXvYqyiOux7qeASFV1PBeieo7/3RAA5SaBExKUn6thKRBmGaza8Uaxi20nVvRakA7AfSsTm4mLtvafJizNVF5XtkHA=

X-Received: by 2002:a5d:4fd0:: with SMTP id

h16mr23339731wrw.255.1580137619395; Mon, 27 Jan 2020 07:06:59 -0800 (PST)

X-VR-STATUS: OK

X-VR-SCORE: 40

X-VR-SPAMCAUSE: gggruggvucftvghtrhhoucdtuddrgedugedrfedvgdejudcutefuodetggdotefrodftvfcurfhrohhfihhlvgemucggtfgfnhhsuhgsshgtrhhisggvpdfftffgtefojffquffvnecuuegrihhlohhuthemuceftddtnecuhfhorhhgvgguucfjvffvrffuucdlgedtmdenucfjughrpefhjghfggffkffuvfgtsegrtderredttdejnecuhfhrohhmpeflohgrnhhnvgcurfhivghtvghrshcuoehjohgrnhhnvgdrphhivghtvghrshessghrohgrugdqsggrnhgushgvrghrtghhrdhnvghtqeenucffohhmrghinhepsghrohgruggsrghnughsvggrrhgthhdrnhgvthdpthhurhhnsggrtghkhhhorgigrdhiugdpshhnohhpvghsrdgtohhmpdhmshhsphhsiidrnhgvthenucfkphepvddtledrkeehrddvvddurdeiieenucevlhhushhtvghrufhiiigvpedtnecurfgrrhgrmhepmhhouggvpehsmhhtphdphhgvlhhopehmrghilhdqfihruddqfheiiedrghhoohhglhgvrdgtohhmpdhinhgvthepvddtledrkeehrddvvddurdeiiedprhgvthhurhhnqdhprghthheplfhorghnnhgvucfrihgvthgvrhhsuceojhhorghnnhgvrdhpihgvthgvrhhssegsrhhorgguqdgsrghnughsvggrrhgthhdrnhgvtheqpdhmrghilhhfrhhomhepjhhorghnnhgvrdhpihgvthgvrhhssegsrhhorgguqdgsrghnughsvggrrhgthhdrnhgvthdpnhhrtghpthhtoheplhgrphhorhesthhurhhnsggrtghkhhhorgigrdhiug

--00000000000080265d059d2075f5

Content-Type: text/plain;

charset=UTF-8

Content-Transfer-Encoding: 7bit

Hi there,

Just checking in one last time - I'm not going full stalker here! Did you

see my previous emails?

I was thinking it might also be an option for us to write a guest post for

you if that works better?

Just like the post I shared with you before, it would be very well written

and researched.

Let me know.

Thanks,

Joanne

Sent from my iPhone

On Wed, Jan 22, 2020 at 11:36 AM "Joanne Pieters" <

joanne.pieters@broad-bandsearch.net> wrote:

Hi there,

I wanted to follow up on my recent Email about your post. Did you get a

chance to read it? I definitely think our content would add to yours.

Let me know what you think.

Thanks,

Joanne

Sent from my iPhone

On Wed, Jan 15, 2020 at 9:01 AM "Joanne Pieters" <

joanne.pieters@broad-bandsearch.net> wrote:

Hi there,

Joanne from Broadbandsearch.net here. I wanted to drop you a note after

reading your post at

https://turnbackhoax.id/2019/07/06/salah-hati-hati-daging-manusia-impor-dari-china/

(awesome read by the way!) and I noticed that you mentioned an article at

snopes.com

We've put together this great piece on Hoaxes, here's the link:

https://www.broadbandsearch.net/blog/craziest-internet-hoaxes

<http://w1.msspsz.net/prod/33e167f1-1c32-4d74-bbdb-285b02a807be/e1b089b5-2436-4c3d-a7ed-f0a19e27d914>

As our post is so in-depth, it's had a great response from our readers. How

about mentioning it in your article as an extra resource?

It will give your readers some more useful information plus it should help

you get even more engagement with your post. A win-win!

Thanks,

Joanne

Sent from my iPhone

--00000000000080265d059d2075f5

Content-Type: text/html;

charset=UTF-8

Content-Transfer-Encoding: quoted-printable

<html><head>

<meta content=3D"text/html; charset=3D" http-equiv=3D"Content-Type">

</head>

<body>Hi there,<br><br>

<div>Just checking in one last time -=C2=A0 I&#39;m not going full stalke=

r here!=C2=A0 Did you see my previous emails?=C2=A0</div>

<div>=C2=A0</div>

<div>I was thinking it might also be an option for us to write a guest po=

st for you if that works better?<br><br>Just like the post I shared with =

you before, it would be very well written and researched.=C2=A0</div>

<div>=C2=A0</div>

<div>Let me know.</div>

<div>=C2=A0</div>

<div>Thanks,</div>

<div>Joanne</div><br><br><br><br>Sent from my iPhone<img alt=3D"" width=3D=

"1" height=3D"1" class=3D"beacon-o" src=3D"http://w1.msspsz.net/prod/open=

/33e167f1-1c32-4d74-bbdb-285b02a807be" style=3D"float:left;margin-left:-1=

px;position:absolute;"><div class=3D"reply-chain"><br><br>On Wed, Jan 22,=

2020 at 11:36 AM &quot;Joanne Pieters&quot; &lt;<a href=3D"mailto:joanne=

.pieters@broad-bandsearch.net">joanne.pieters@broad-bandsearch.net</a>&gt=

; wrote:<br>Hi there,<br><br>I wanted to follow up on my recent Email abo=

ut your post. Did you get a chance to read it?=C2=A0I definitely think ou=

r content would add to yours.<br><br>Let me know what you think.<br><br>T=

hanks,<br>Joanne<br><br><br><br>Sent from my iPhone<br><br>On Wed, Jan 15=

, 2020 at 9:01 AM &quot;Joanne Pieters&quot; &lt;<a href=3D"mailto:joanne=

.pieters@broad-bandsearch.net">joanne.pieters@broad-bandsearch.net</a>&gt=

; wrote:<br><div>Hi there,</div>

<div>=C2=A0</div>

<div>Joanne from Broadbandsearch.net here. I wanted to drop you a note af=

ter reading your post at <a href=3D"https://turnbackhoax.id/2019/07/06/sa=

lah-hati-hati-daging-manusia-impor-dari-china/">https://turnbackhoax.id/2=

019/07/06/salah-hati-hati-daging-manusia-impor-dari-china/</a> (awesome r=

ead by the=C2=A0 way!) and I noticed that you mentioned an article at <a =

href=3D"http://snopes.com">snopes.com</a></div>

<div>=C2=A0</div>

<div>We&#39;ve put together this great piece on Hoaxes, here&#39;s the li=

nk:=C2=A0<a href=3D"http://w1.msspsz.net/prod/33e167f1-1c32-4d74-bbdb-285=

b02a807be/e1b089b5-2436-4c3d-a7ed-f0a19e27d914">https://www.broadbandsear=

ch.net/blog/craziest-internet-hoaxes</a></div>

<div>As our post is so in-depth, it&#39;s had a great response from our r=

eaders. How about mentioning it in your article as an extra resource?<br>=

<br>It will give your readers some more useful information plus it should=

help you get even more engagement with your post. A win-win!</div>

<div>=C2=A0</div>

<div>Thanks,<br><br></div>

<div>Joanne</div><br><br><br><br>Sent from my iPhone</div></body>

</html>

--00000000000080265d059d2075f5--