Project

Profile

Help

Task #466 ยป Task #466 - 2018-06-01T15_46_22Z.eml

Harry Sufehmi, 06/01/2018 05:46 PM

 
1
Return-Path: <sufehmi@gmail.com>
2
Received: from m.launchco.com ([127.0.0.1]) by m.launchco.com (Dovecot) with LMTP id FYRjLYlpEVtFCQAAa1G0NA for <dropbox@plan.io>; Fri, 01 Jun 2018 17:46:00 +0200
3
Received: from homiemail-mx8.g.dreamhost.com (mx2.sub3.homie.mail.dreamhost.com [69.163.253.9]) (using TLSv1 with cipher DHE-RSA-AES256-SHA (256/256 bits)) (No client certificate requested) by m.launchco.com (Postfix) with ESMTPS id E383520689 for <inbox+rlxc+36be+hoax-clearing-center@plan.io>; Fri, 01 Jun 2018 17:45:59 +0200
4
Received: from vade-backend5.dreamhost.com (agjbgdcfdaaf.dreamhost.com [69.163.253.5]) (using TLSv1 with cipher ADH-AES256-SHA (256/256 bits)) (No client certificate requested) by homiemail-mx8.g.dreamhost.com (Postfix) with ESMTPS id BA0E7104E584 for <lapor@turnbackhoax.id>; Fri, 01 Jun 2018 08:45:57 -0700
5
Received: from mail-it0-f65.google.com (mail-it0-f65.google.com [209.85.214.65]) by vade-backend5.dreamhost.com (Postfix) with ESMTPS id 519476238F82C for <lapor@turnbackhoax.id>; Fri, 01 Jun 2018 08:45:57 -0700
6
Received: by mail-it0-f65.google.com with SMTP id 76-v6so2343028itx.4 for <lapor@turnbackhoax.id>; Fri, 01 Jun 2018 08:45:57 -0700
7
Received: from 629026133089 named unknown by gmailapi.google.com with HTTPREST; Fri, 01 Jun 2018 08:45:54 -0700
8
Date: Fri, 01 Jun 2018 08:45:54 -0700
9
From: sufehmi@gmail.com
10
Reply-To: mobilum_panokuan@yahoo.com
11
To: lapor@turnbackhoax.id
12
Message-ID: <CAOTKKcuS7rqGBhUnEMqgdFqEsN4D9xc2nsK3HkM0kEResX9oZw@mail.gmail.com>
13
Subject: TurnBackHoax "Peristiwa Mei 1998 dinyatakan oleh penulis
14
 www.eramuslim.com adalah HOAX"
15
Mime-Version: 1.0
16
Content-Type: text/plain;
17
 charset=UTF-8
18
Content-Transfer-Encoding: quoted-printable
19
X-He-Spam-Score: -1.0
20
Delivered-To: <dropbox@plan.io>
21
X-Spam-Checker-Version: SpamAssassin 3.4.0 (2014-02-07) on m.launchco.com
22
X-Spam-Level: 
23
X-Spam-Status: No, score=-1.0 required=5.0 tests=BAYES_00,DKIM_SIGNED,
24
 DKIM_VALID,DKIM_VALID_AU,FREEMAIL_FROM,FREEMAIL_REPLYTO,RCVD_IN_DNSWL_NONE,
25
 UNPARSEABLE_RELAY autolearn=no autolearn_force=no version=3.4.0
26
X-Spam-Report: * -0.0 RCVD_IN_DNSWL_NONE RBL: Sender listed at
27
 http://www.dnswl.org/, no * trust * [69.163.253.9 listed in list.dnswl.org] *
28
 0.0 FREEMAIL_FROM Sender email is commonly abused enduser mail provider *
29
 (sufehmi[at]gmail.com) * -1.9 BAYES_00 BODY: Bayes spam probability is 0 to 1%
30
 * [score: 0.0000] * -0.1 DKIM_VALID Message has at least one valid DKIM or DK
31
 signature * 0.1 DKIM_SIGNED Message has a DKIM or DK signature, not
32
 necessarily * valid * -0.1 DKIM_VALID_AU Message has a valid DKIM or DK
33
 signature from author's * domain * 0.0 UNPARSEABLE_RELAY Informational:
34
 message has unparseable relay lines * 1.0 FREEMAIL_REPLYTO Reply-To/From or
35
 Reply-To/body contain different * freemails
36
X-Spam-Score: -1.0
37
Envelope-to: inbox+rlxc+36be+hoax-clearing-center@plan.io
38
Authentication-Results: m.launchco.com; dmarc=pass header.from=gmail.com
39
Authentication-Results: m.launchco.com; dkim=pass reason="2048-bit key;
40
 unprotected key" header.d=gmail.com header.i=@gmail.com header.b=ciBILXqf;
41
 dkim-adsp=pass; dkim-atps=neutral
42
Authentication-Results: vade-backend5.dreamhost.com; dkim=pass
43
 reason="2048-bit key; unprotected key" header.d=gmail.com header.i=@gmail.com
44
 header.b=ciBILXqf; dkim-adsp=pass; dkim-atps=neutral
45
DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=gmail.com; s=20161025;
46
 h=from:reply-to:mime-version:date:message-id:subject:to
47
 :content-transfer-encoding; bh=FvGRaXUxkA9rt9Vw5t03gZijCSEgkDfSmPBSZ665SEg=;
48
 b=ciBILXqfnsiswFJfI+H1AFAszUWE80SOcAzfvSkX/48S2nknh7OJZ1H4xZtU8fWx1l
49
 55yBthvge9dEOP1kpNu/v7OyBI41rBWDDwAE/J159sP5ywrn25qbChv3lzZJesaV3Q7J
50
 UOv94rMTR9cHYtFoQNci9w34QzgibJaK7HfUFZHYat58XK4Z9anENeenUMskIvFSWE3X
51
 F5YWN+RVWwGo+REPlaP8zYDiB54a3R0nw/FPwq1f83vSJ1x8QOKL2UtaxsSlrniy9HzP
52
 X7NZS4i+XhKjAEnz8X72HVR4qV8viliaE7RC2Y1q3fnCdbmdSwUFksBvCyFV4gUEVHHF 1zzA==
53
X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net;
54
 s=20161025; h=x-gm-message-state:from:reply-to:mime-version:date:message-id
55
 :subject:to:content-transfer-encoding;
56
 bh=FvGRaXUxkA9rt9Vw5t03gZijCSEgkDfSmPBSZ665SEg=;
57
 b=eMRM7NBetQ/g39QS9PZJqrfu2Ikz1xjHT6nCTiMuiI65wQpbbwJui8QkcGNeGr5pqL
58
 0Osyd72TdHdyR4H8dzTrVzSDHhZO6PhcS34l9beet4AkfOLa13GgBT8k8PvEvkT6fc1w
59
 8b55ZVVDlb+sVGB45QqY8JC06m2T0vABKELRh7iheDPLefDs6FuuY92mwtSbhsWnOEnt
60
 tga9kf4zCBMxFDpP9P4Ix09O6+kabIepLZC8GpdoyixuH4AapKQVpGrV/sCyuJ4jfdf7
61
 AHTFnUcvTIfiYIanSC5zndwNEclf9sYz0pnMH0gEeEPNUeNTsvYHCR8vmk1W9RfdfZo+ Ifag==
62
X-Gm-Message-State: ALKqPwfHfTjW7/y2+djAkjpYkJIZlUIAC2HzqnDW2nT949etGC9XUBE0
63
 VKDoFiB8JS2hYl8ny3ywc3KGYuYUkdkoqGdDsky3NA==
64
X-Google-Smtp-Source: ADUXVKK36kPIDEuFtNsjsEY5oC6SPtrMRgzbKsAf/JiqGOsrnniSpk16NuHMd7d7RW7LD2R/RmzSF/1jynpKymCXdY0=
65
X-Received: by 2002:a24:fe46:: with SMTP id
66
 w67-v6mr4976301ith.22.1527867956246; Fri, 01 Jun 2018 08:45:56 -0700 (PDT)
67
X-Mailer: WPMailSMTP/Mailer/gmail 1.2.5
68
X-VR-STATUS: OK
69
X-VR-SCORE: 0
70
X-VR-SPAMCAUSE: gggruggvucftvghtrhhoucdtuddrgedthedrieeggdeklecutefuodetggdotefrodftvfcurfhrohhfihhlvgemucggtfgfnhhsuhgsshgtrhhisggvpdfftffgtefojffquffvnecuuegrihhlohhuthemuceftddtnecunecujfgurhephfhrofggfffkuffvtgfgsehtqhertdertdejnecuhfhrohhmpehsuhhfvghhmhhisehgmhgrihhlrdgtohhmnecuffhomhgrihhnpegtvghkfhgrkhhtrgdrtghomhdpvghrrghmuhhslhhimhdrtghomhdpthhurhhnsggrtghkhhhorgigrdhiugenucfkphepvddtledrkeehrddvudegrdeiheenucfrrghrrghmpehmohguvgepshhmthhppdhhvghlohepmhgrihhlqdhithdtqdhfieehrdhgohhoghhlvgdrtghomhdpihhnvghtpedvtdelrdekhedrvddugedrieehpdhrvghtuhhrnhdqphgrthhhpehsuhhfvghhmhhisehgmhgrihhlrdgtohhmpdhmrghilhhfrhhomhepshhufhgvhhhmihesghhmrghilhdrtghomhdpnhhrtghpthhtoheplhgrphhorhesthhurhhnsggrtghkhhhorgigrdhiugenucevlhhushhtvghrufhiiigvpedt
71

    
72
From: Mobilum panokuan <mobilum_panokuan@yahoo.com>
73
Subject: Peristiwa Mei 1998 dinyatakan oleh penulis www.eramuslim.com
74
adalah HOAX
75

    
76
Pesan dari Pelapor:
77

    
78
Mohon cek artikel/berita tsb benar atau hoax ?
79
Karena kami juga ikut MELAWAN HOAX  a.l di beberapa WAG yg saya ikuti
80
banyak di-posting berita hoax,
81
Artikel di atas sdh sy cek di HBT & www.turnbackhoax.id & di
82
www.cekfakta.com, tetapi blm ada tersedia infonya.
83
Bls & trm ksh
84

    
85
=3D=3D=3D=3D=3D=3D
86
Isi Hoax :
87

    
88
=F0=9F=9B=91=F0=9F=86=98=F0=9F=9B=91
89
*TERUNGKAP! Ternyata Berita Pemerkosaan Massal atas Etnis Tertentu di
90
Kerusuhan Mei 98 HOAX*
91
https://www.eramuslim.com/berita/nasional/terungkap-ternyata-berita-pemer=
92
kosaan-massal-etnis-cina-di-kerusuhan-mei-98-hoax.htm
93
_22 Mei 2018_
94

    
95
Eramuslim =E2=80=93 Usai meliput di Monumen Mahatma Gandhi dan Museum
96
Jawaharlal Nehru di New Delhi, saya menuju Wisa Duta Kedutaan Besar
97
Republik Indonesia di kawasan Chanakyapuri, New Delhi, India.
98

    
99
Petang itu pada akhir Mei 2011 lalu, saya diterima Duta Besar Luar
100
Biasa dan Berkuasa Penuh Republik Indonesia untuk India, Letnan
101
Jenderal (Purn) Andi Muhammad Ghalib.
102

    
103
_=E2=80=9CShubh sundhyaa. Aapka swaagat haiPA_ katanya dalam bahasa India=
104
.Ia
105
tersenyum dan meminta saya membuka kamus bahasa India. Ungkapan itu
106
berarti selamat malam dan selamat datang.
107

    
108
Salah satu obrolan malam itu seputar peristiwa kerusuhan Mei 1998.
109
Ghalib pada Mei 1998 masih sebagai Kepala Badan Pembinaan Hukum
110
(Kababinkum) ABRI, dengan pangkat mayor jenderal. Hampir tiga tahun ia
111
menyandang pangkat mayor jenderal dalam usia menjelang 53 tahun.
112
Jabatan sebelumnya adalah Oditur Jenderal ABRI istilah lain untuk
113
jaksa agung militer.
114

    
115
Namun pertanyaan saya bukan dalam kapasitasnya sebagai Oditur Jenderal
116
ABRI maupun Kababinkum ABRI, melainkan sebagai Jaksa Agung. Ia
117
dilantik Presiden BJ Habibie sebagai Jaksa Agung pada 15 Juni 1998.
118
Sekaligus dinaikkan pangkatnya menjadi letnan jenderal. Sebuah hadiah
119
hari kelahirannya ke 53 tahun.
120

    
121
Salah satu pertayaan saya yang membuat dia harus bolak balik ke meja
122
kerjanya, seputar isu perkosaan massal pada kerusuhan Mei 1998.
123
_*=E2=80=9CBohong itu! Merusak citra Indonesia di mata dunia. Ada orang C=
124
ina
125
yang kurangajar membuat CERITA PALSU di Amerika,=E2=80=9D*_ kata Ghalib. =
126
Ia
127
meminta saya menghubungi Letnan Jenderal (Purn) Moetojib, jika sudah
128
kembali ke Jakarta.
129

    
130
Ghalib pun menceritakan sebagai jaksa agung mendapatkan laporan
131
tentang berita bohong _*(HOAX dalam istilah sekarang)*_ tersebut.
132
Termasuk berkoordinasi dengan Kepala Badan Koordinasi Intelijen Negara
133
(Bakin), Letnan Jenderal (Purn) Moetojib dan Kepala Polri, Letnan
134
Jenderal Polisi Roesmanhadi.
135

    
136
Ia kemudian memperlihatkan dokumen dari FBI, Biro Penyelidik Amerika.
137
Lembaga itu menyatakan bahwa kasus perkosaan massal merupakan _*MODUS
138
PENIPUAN DARI SEJUMLAH WARGA KETURUNAN CINA DI INDONESIA UNTUK
139
MENDAPATKAN "SUAKA POLITIK.*_ dus penipuan dari sejumlah warga
140
keturunan Cina di Indonesia untuk mendapatkan suaka politik. Dokumen
141
tersebut didapatnya saat menjadi anggota DPR RI pada 2004-2009.
142

    
143
Dokumen FBI 2004 itu, menurut Ghalib memperkuat hasil tim khusus yang
144
dibuat pemerintah BJ Habibie pada 1999. Dalam laporan tim, _*tidak
145
ditemukan data-data dan fakta-fakta,*_ baik di rumah sakit, maupun
146
apartemen yang disebutkan telah terjadi perkosaan massal itu.
147

    
148
Ya, FBI melaporkan dalam sebuah operasi dengan nama sandi Operation
149
Jakarta. Mereka menangkap 26 anggota sindikat pemalsu dokumen suaka.
150
Operasi rahasia dilakukan serentak di lebih dari 10 negara bagian di
151
Amerika Serikat.
152

    
153
_*=E2=80=9CPemimpin sindikat ini adalah Hans Guow, WNI keturunan Cina, =E2=
154
=80=9D*_
155
kata Jaksa Penuntut Wilayah Virginia, Paul J McNulty yang menangani
156
kasus ini.
157

    
158
Kami membaca dokumen rahasia itu di ruang makan keluarga, sambil makan
159
malam ditemani Andi Murniati, istri Andi Muhammad Ghalib.
160

    
161
Itulah operasi yang dilakukan terhadap sejumlah WNI keturunan Cina
162
yang meminta suaka politik dengan alasan menjadi korban perkosaan
163
dalam peristiwa Mei 1998 di Jakarta dan sekitarnya.
164

    
165
Setelah menyelidiki selama dua tahun, pada Senin, 22 November 2004
166
satuan tugas rahasia pemerintah Amerika Serikat menggelar operasi
167
tersebut. Para tersangka dikenai tuduhan sama, yakni _*memalsukan
168
dokumen suaka serta berkonspirasi dalam pemalsuan berbagai dokumen.*_
169

    
170
Awalnya, mereka hanya membantu menyediakan dokumen _*asli tapi
171
palsu.*_ Setelah berhasil mengelabui pihak berwenang dengan memalsukan
172
izin kerja dan nomor jaminan sosial, mereka mulai menyiapkan aplikasi
173
suaka politik palsu.
174
Menyiapkan skenario pengakuan palsu seperti diperkosa atau dianiaya
175
dalam kerusuhan Mei 1998.
176

    
177
=E2=80=9CCerita tentang penyiksaan itu sangat seragam, karena para pencar=
178
i
179
suaka _*menghafalkan kata demi kata secara persis*_ seperti yang
180
diajarkan,=E2=80=9D kata Jaksa McNulty.
181

    
182
Mereka pun _mengajari kliennya_ untuk menangis meraung-raung dan
183
memohon dengan emosional untuk mengundang simpati petugas. Banyak yang
184
menceritakan kisahnya begitu sama persis. Misalnya, diperkosa sopir
185
taksi. Pengakuan itu meluncur dari mulut 14 perempuan WNI keturunan
186
Cina yang mengajukan permohonan suaka sejak 31 Oktober 2000 hingga 6
187
Januari 2002.
188

    
189
=E2=80=9CMereka mengaku diperkosa karena sebagai WNI keturunan Cina,=E2=80=
190
=9D kata
191
Dean McDonald, agen spesial dari Biro Imigrasi dan Bea Cukai
192
Kepabeanan Departemen Keamanan Dalam Negeri Amerika Serikat di negara
193
bagian Virginia.
194

    
195
Voice of Amerika juga membuat liputan investigatif tentang isu
196
perkosaan massal itu. Mereka keluar masuk berbagai lokasi yang
197
dicurigai sebagai=C2=A0 tempat kejadian perkara perkosaan massal, dan
198
mencoba mewawancarai berbagai pihak. Tapi _*hasilnya nihil!*_
199

    
200
Memang ada kasus perkosaan, tetapi bukan massal. Bukan hanya pada Mei
201
1998. Hampir tiap bulan juga ada kasus perkosaan di sejumlah tempat di
202
Jakarta dan lainnya. Kasus kriminal biasa. _*Hasil penyidikan FBI
203
akhirnya membongkar kebohongan itu.=C2=A0*_
204

    
205
Itulah salah satu isu dahsyat tentang pemerkosaan massal atas para
206
perempuan etnis Cina pada saat kerusuhan Mei 1998. Dengan sistematis
207
mereka meniupkan isu tentang isu perkosaan itu, dengan berbagai cerita
208
di berbagai media, dengan berbagai cara dan sarana, baik di dalam dan
209
luar negeri.
210

    
211
Yang paling kontroversial adalah kisah hoax yang diceritakan seorang
212
gadis keturunan Cina bernama Vivian. Cerita palsu itu muncul pada
213
pertengahan Juni 1998.=C2=A0 Di situ ia mengaku tinggal bersama orang
214
tuanya di lantai 7 sebuah apartemen di kawasan Kapuk, Jakarta Utara.
215

    
216
Saat penyerbuan itu mereka memperkosa Vivian, saudara, tante dan
217
tetangga-tetangganya. Kisahnya ditulis secara deskriptif, detail dan
218
menyentuh, sehingga mampu membangkitkan emosi. Bahkan =E2=80=98Majalah
219
Jakarta-Jakarta=E2=80=99 mengutip cerita perkosaan itu.
220

    
221
Sayang sekali majalah tersebut menyebarkan _*berita hoax yang
222
mempermalukan bangsa Indonesia.*_
223
Di internet pun muncul foto-foto berisi gambar para korban kerusuhan
224
Mei 1998. Sejumlah website memuat foto-foto yang luar biasa sadis dan
225
mencekam, seolah-olah sebagai foto kerusuhan Mei 1998 dan
226
korban-korban perkosaan massal itu.
227

    
228
Tayangan tersebut mengundang emosi luar biasa bagi etnis Cina di
229
seluruh dunia. Mereka menuduh orang-orang Cina di Indonesia akan
230
dibinasakan, seperti kasus The Rape of Nanking, saat pendudukan Jepang
231
ke Cina, pada 1937.
232

    
233
Setelah pengakuan Vivian itu, para wartawan dalam dan luar negeri
234
berupaya menelusuri petunjuk tersebut, Hasilnya nihil. Hal yang sama
235
dialami aparat kepolisian dan Tim Gabungan Pencari Fakta (TGPF),
236
hasilnya pun sama, nihil!
237

    
238
Warga di sekitar apartemen yang disebut sebagai tempat tinggal Vivian
239
menjawab, tidak ada dan tidak pernah terdengar adanya=C2=A0 remaja putri
240
Cina yang diperkosa saat kerusuhan Mei 1998.=C2=A0 Beberapa saksi=C2=A0 m=
241
alah
242
menyebutkan, mereka sudah kabur ke luar negeri sebelum peristiwa
243
kerusuhan itu.
244

    
245
Seperti saran Ghalib, saya pun menemui Moetojib saat kembali ke
246
Jakarta. Ceritanya pun sama. Bangsa Indonesia dipermalukan WNI
247
keturunan Cina yang membuat berita bohong.
248

    
249
Jadi, jika masih ada yang percaya tentang kasus perkosaan massal
250
terhadap WNI keturunan Cina pada Mei 1998, segera beranguslah dari
251
pikiran busuk itu. (rol)
252

    
253
_*=C2=A0Selamat Ginting, Jurnalis Republika*_
254

    
255
_mohon diviralkan_
256

    
257
-- =
258

    
259
This e-mail was sent from a contact form on TurnBackHoax
260
(https://www.turnbackhoax.id/lapor-hoax/)
    (1-1/1)