Project

Profile

Help

Task #10271 ยป Re_ Link Bansos Kota depok [#10271][8dc6fb] - 2020-04-13T17_23_38Z.eml

Anonymous, 04/13/2020 07:23 PM

 
1
X-He-Spam-Score: -2.0
2
Return-Path: <oscardsketuakki@gmail.com>
3
Delivered-To: dropbox@plan.io
4
Received: from m.launchco.com ([127.0.0.1])
5
	by m.launchco.com with LMTP id oGfvMA+glF4zFgAAa1G0NA
6
	for <dropbox@plan.io>; Mon, 13 Apr 2020 19:23:27 +0200
7
X-Spam-Checker-Version: SpamAssassin 3.4.2 (2018-09-13) on m.launchco.com
8
X-Spam-Level: 
9
X-Spam-Status: No, score=-2.0 required=5.0 tests=BAYES_00,DKIM_SIGNED,
10
	DKIM_VALID,DKIM_VALID_AU,FREEMAIL_FROM,HTML_MESSAGE,RCVD_IN_DNSWL_NONE,
11
	SPF_HELO_NONE autolearn=ham autolearn_force=no version=3.4.2
12
X-Spam-Report: 
13
	* -0.0 RCVD_IN_DNSWL_NONE RBL: Sender listed at
14
	*      https://www.dnswl.org/, no trust
15
	*      [64.90.62.139 listed in list.dnswl.org]
16
	* -1.9 BAYES_00 BODY: Bayes spam probability is 0 to 1%
17
	*      [score: 0.0000]
18
	*  0.0 FREEMAIL_FROM Sender email is commonly abused enduser mail
19
	*      provider (oscardsketuakki[at]gmail.com)
20
	*  0.0 SPF_HELO_NONE SPF: HELO does not publish an SPF Record
21
	*  0.0 HTML_MESSAGE BODY: HTML included in message
22
	* -0.1 DKIM_VALID_AU Message has a valid DKIM or DK signature from
23
	*      author's domain
24
	* -0.1 DKIM_VALID Message has at least one valid DKIM or DK signature
25
	*  0.1 DKIM_SIGNED Message has a DKIM or DK signature, not necessarily
26
	*       valid
27
X-Spam-Score: -2.0
28
Envelope-to: inbox+rlxc+36be+hoax-clearing-center@plan.io
29
Authentication-Results: m.launchco.com; dmarc=pass (p=none dis=none) header.from=gmail.com
30
Authentication-Results: m.launchco.com;
31
	dkim=pass (2048-bit key; unprotected) header.d=gmail.com header.i=@gmail.com header.b="MfzQC3HI";
32
	dkim-atps=neutral
33
Received: from pdx1-sub0-mail-fallback-mx1.dreamhost.com (pdx1-sub0-mail-fallback-mx1.dreamhost.com [64.90.62.139])
34
	(using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits))
35
	(No client certificate requested)
36
	by m.launchco.com (Postfix) with ESMTPS id 5303282DD8
37
	for <inbox+rlxc+36be+hoax-clearing-center@plan.io>; Mon, 13 Apr 2020 19:23:27 +0200 (CEST)
38
Received: from pdx1-sub0-mail-mx70.g.dreamhost.com (unknown [10.35.43.86])
39
	(using TLSv1.2 with cipher AECDH-AES256-SHA (256/256 bits))
40
	(No client certificate requested)
41
	by pdx1-sub0-mail-fallback-mx1.dreamhost.com (Postfix) with ESMTPS id E3C8417B63A
42
	for <inbox+rlxc+36be+hoax-clearing-center@plan.io>; Mon, 13 Apr 2020 10:23:24 -0700 (PDT)
43
Received: from vade-backend5.dreamhost.com (fltr-in2.mail.dreamhost.com [66.33.205.213])
44
	(using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits))
45
	(No client certificate requested)
46
	by pdx1-sub0-mail-mx70.g.dreamhost.com (Postfix) with ESMTPS id F22359D6D2
47
	for <lapor@turnbackhoax.id>; Mon, 13 Apr 2020 10:22:50 -0700 (PDT)
48
Received: from mail-ed1-f43.google.com (mail-ed1-f43.google.com [209.85.208.43])
49
	by vade-backend5.dreamhost.com (Postfix) with ESMTPS id 898CF404A6803
50
	for <lapor@turnbackhoax.id>; Mon, 13 Apr 2020 10:22:50 -0700 (PDT)
51
Received: by mail-ed1-f43.google.com with SMTP id c7so13050767edl.2
52
        for <lapor@turnbackhoax.id>; Mon, 13 Apr 2020 10:22:50 -0700 (PDT)
53
DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed;
54
        d=gmail.com; s=20161025;
55
        h=mime-version:references:in-reply-to:from:date:message-id:subject:to;
56
        bh=IZPJ+7md9zduVZCg0IuUFY62FWmfdsAva0H4IWRTQKs=;
57
        b=MfzQC3HIbMc4BN+D5hGVc/NFTOVkjT5y/7Xkns98PY2Fvji7T1CMxHz4gR9dZZgPqX
58
         Nec1Wlcrdv6TQSzCwwBNktH9KW3F6DeCxX2QfNEUki0dLnit8PsX5MwVQmV+tHaUCYq9
59
         N6CV7fg0shhX/3OKHdqD0JWCcMc6q2DJVfAGvU56loAoTM7w8k1ur7HknufAEaB/zJjY
60
         lNAQrLTzVsF8Y/WiqvOmU6hTbINH5oi0pxg2vYsZY+zXcDKpTNTAoHgFD1MezKvuMp+l
61
         qohQYiYPvjFjyUBJuqOk303j2UHG+V6hNunC6z7PPMw8+rI1kGZT5nKyVfFHyxuwZk06
62
         Bdew==
63
X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed;
64
        d=1e100.net; s=20161025;
65
        h=x-gm-message-state:mime-version:references:in-reply-to:from:date
66
         :message-id:subject:to;
67
        bh=IZPJ+7md9zduVZCg0IuUFY62FWmfdsAva0H4IWRTQKs=;
68
        b=TtYVuSHnTOXKRsr2xMW5+yZv2mkBEk2P689hxBOeMguDQ2PRMv3froOOSrCvYInuKt
69
         dNNAdSYCrbdu1mrHKwOB4G+D6UPU5dyC02mkA8DHyu7cb/sYAnvVuxwfSHIgMxReCtC4
70
         oq0dVsDYXiN3bxALUz4YK4lrDWGUzTHYr2knwQ97+s/LqqBus/uGyekWKUewbJtVgQWJ
71
         GNPoPh78sSJNX4f/89oRLgfsgk8unh+SWkOIDPRk6Pe2OTyGDQ9Z4509qZtMdVUeEzLf
72
         h4o1n2OfstQwRRbj1CwNANWQApFCehIDswUmL6XnjEO2jdKczjeQugpN88MR0LjnRb/D
73
         xg0g==
74
X-Gm-Message-State: AGi0Puac+RgslXjBUU+6J+UDunsCCAjy+p4w4vOZ/mEOa3dEvn5YXvRs
75
	EDbHc89QSufZ6dw8950auBZiMHDGwdY+IYuEIAzyWw==
76
X-Google-Smtp-Source: APiQypKgmrc/n4aZIx9EXQMSldRGOuNWBeGpjiW4+F91y1raAcXKJl4bb2m1u4+Nm27gM3Ujo0sNbKWHr5pOWu9CZnQ=
77
X-Received: by 2002:a17:906:808:: with SMTP id e8mr13202726ejd.372.1586798569003;
78
 Mon, 13 Apr 2020 10:22:49 -0700 (PDT)
79
MIME-Version: 1.0
80
References: <redmine.issue-10271.20200413160701@plan.io> <5e948e2594153_63192af60318f9748473b@fsn1-app05.mail>
81
In-Reply-To: <5e948e2594153_63192af60318f9748473b@fsn1-app05.mail>
82
From: Oscar dany Susanto <oscardsketuakki@gmail.com>
83
Date: Tue, 14 Apr 2020 00:22:37 +0700
84
Message-ID: <CALJCo3_-k3PA3nW0bMVjHzxw0xF0+TzRTjn=grVqCzNW1S3pfQ@mail.gmail.com>
85
Subject: Re: Link Bansos Kota depok [#10271][8dc6fb]
86
To: Dashboard <lapor@turnbackhoax.id>
87
Content-Type: multipart/alternative; boundary="000000000000091ce305a32f55e6"
88
X-VR-STATUS: OK
89
X-VR-SCORE: 0
90
X-VR-SPAMCAUSE: gggruggvucftvghtrhhoucdtuddrgeduhedrvdelgdduudefucetufdoteggodetrfdotffvucfrrhhofhhilhgvmecuggftfghnshhusghstghrihgsvgdpffftgfetoffjqffuvfenuceurghilhhouhhtmecufedttdenucenucfjughrpeggfhgjhfffkffuvfgtsegrtderredttdejnecuhfhrohhmpefqshgtrghrucgurghnhicuufhushgrnhhtohcuoehoshgtrghrughskhgvthhurghkkhhisehgmhgrihhlrdgtohhmqeenucffohhmrghinhepphhlrghnrdhiohenucfkphepvddtledrkeehrddvtdekrdegfeenucevlhhushhtvghrufhiiigvpedtnecurfgrrhgrmhepmhhouggvpehsmhhtphdphhgvlhhopehmrghilhdqvgguuddqfhegfedrghhoohhglhgvrdgtohhmpdhinhgvthepvddtledrkeehrddvtdekrdegfedprhgvthhurhhnqdhprghthhepqfhstggrrhcuuggrnhihucfuuhhsrghnthhouceoohhstggrrhgushhkvghtuhgrkhhkihesghhmrghilhdrtghomheqpdhmrghilhhfrhhomhepohhstggrrhgushhkvghtuhgrkhhkihesghhmrghilhdrtghomhdpnhhrtghpthhtoheplhgrphhorhesthhurhhnsggrtghkhhhorgigrdhiug
91

    
92
--000000000000091ce305a32f55e6
93
Content-Type: text/plain; charset="UTF-8"
94

    
95
Maksudnya gimana ?? Saya nggak ngerti .
96

    
97
Pada tanggal Sen, 13 Apr 2020 23.07, Dashboard <lapor@turnbackhoax.id>
98
menulis:
99

    
100
> --- In your reply, please do not write below this line ---
101
>
102
> Dear Oscardsketuakki :
103
>
104
> We hereby confirm that we have received your message.
105
>
106
> Subject of your request: Link Bansos Kota depok
107
> Case ID: [#10271 <https://rlxc.plan.io/issues/10271>][8dc6fb]
108
>
109
> Many frequently asked questions are answered online, for example:
110
>
111
> I have forgotten my password. How can I retrieve a new one?
112
> https://rlxc.plan.io/faqs?c=8dc6fb&i=10271#item-4
113
>
114
> You can find more frequent questions at:
115
> https://rlxc.plan.io/projects/hoax-clearing-center/faqs?c=8dc6fb&i=10271
116
>
117
> Maybe these help address your request faster. Otherwise, we will get back
118
> to you as soon as possible.
119
>
120
> You can access the current status of your request via this link:
121
> https://rlxc.plan.io/track/10271/8dc6fb
122
>
123
> --
124
> Cheerfully delivered by Planio Help Desk
125
> <https://plan.io/customer-service-and-help-desk/>
126
> Tracking URI for this request: https://rlxc.plan.io/track/10271/8dc6fb
127
> Answers to frequently asked questions:
128
> https://rlxc.plan.io/projects/hoax-clearing-center/faqs?c=8dc6fb&i=10271
129
>
130

    
131
--000000000000091ce305a32f55e6
132
Content-Type: text/html; charset="UTF-8"
133
Content-Transfer-Encoding: quoted-printable
134

    
135
<div dir=3D"auto">Maksudnya gimana ?? Saya nggak ngerti .</div><br><div cla=
136
ss=3D"gmail_quote"><div dir=3D"ltr" class=3D"gmail_attr">Pada tanggal Sen, =
137
13 Apr 2020 23.07, Dashboard &lt;<a href=3D"mailto:lapor@turnbackhoax.id">l=
138
apor@turnbackhoax.id</a>&gt; menulis:<br></div><blockquote class=3D"gmail_q=
139
uote" style=3D"margin:0 0 0 .8ex;border-left:1px #ccc solid;padding-left:1e=
140
x"><u></u>
141

    
142

    
143

    
144

    
145

    
146
<div>
147
<p>--- In your reply, please do not write below this line ---</p>
148

    
149

    
150
	<p>Dear Oscardsketuakki :</p>
151

    
152

    
153
	<p>We hereby confirm that we have received your message.</p>
154

    
155

    
156
	<p>Subject of your request: Link Bansos Kota depok<br>Case ID: [<a href=3D=
157
"https://rlxc.plan.io/issues/10271" target=3D"_blank" rel=3D"noreferrer">#1=
158
0271</a>][8dc6fb]</p>
159

    
160

    
161
	<p>Many frequently asked questions are answered online, for example:</p>
162

    
163

    
164
	<p>I have forgotten my password. How can I retrieve a new one?<br><a href=
165
=3D"https://rlxc.plan.io/faqs?c=3D8dc6fb&amp;i=3D10271#item-4" target=3D"_b=
166
lank" rel=3D"noreferrer">https://rlxc.plan.io/faqs?c=3D8dc6fb&amp;i=3D10271=
167
#item-4</a></p>
168

    
169

    
170
	<p>You can find more frequent questions at: <a href=3D"https://rlxc.plan.i=
171
o/projects/hoax-clearing-center/faqs?c=3D8dc6fb&amp;i=3D10271" target=3D"_b=
172
lank" rel=3D"noreferrer">https://rlxc.plan.io/projects/hoax-clearing-center=
173
/faqs?c=3D8dc6fb&amp;i=3D10271</a></p>
174

    
175

    
176
	<p>Maybe these help address your request faster. Otherwise, we will get ba=
177
ck to you as soon as possible.</p>
178

    
179

    
180
	<p>You can access the current status of your request via this link: <a hre=
181
f=3D"https://rlxc.plan.io/track/10271/8dc6fb" target=3D"_blank" rel=3D"nore=
182
ferrer">https://rlxc.plan.io/track/10271/8dc6fb</a></p>
183

    
184

    
185
	<p>--<br>Cheerfully delivered by <a href=3D"https://plan.io/customer-servi=
186
ce-and-help-desk/" target=3D"_blank" rel=3D"noreferrer">Planio Help Desk</a=
187
><br>Tracking URI for this request: <a href=3D"https://rlxc.plan.io/track/1=
188
0271/8dc6fb" target=3D"_blank" rel=3D"noreferrer">https://rlxc.plan.io/trac=
189
k/10271/8dc6fb</a><br>Answers to frequently asked questions: <a href=3D"htt=
190
ps://rlxc.plan.io/projects/hoax-clearing-center/faqs?c=3D8dc6fb&amp;i=3D102=
191
71" target=3D"_blank" rel=3D"noreferrer">https://rlxc.plan.io/projects/hoax=
192
-clearing-center/faqs?c=3D8dc6fb&amp;i=3D10271</a></p>
193
</div>
194

    
195
</blockquote></div>
196

    
197
--000000000000091ce305a32f55e6--
    (1-1/1)